SCOP 1.71: Domain d1ndh_1: 1ndh 3-125

Lineage for d1ndh_1 (1ndh 3-125)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein cytochrome b5 reductase [50427] (3 species)

7. Species Pig (Sus scrofa), liver [TaxId:9823] [50428] (1 PDB entry)

8. Domain d1ndh_1: 1ndh 3-125 [25662]
   Other proteins in same PDB: d1ndh_2
   complexed with fad

Details for d1ndh_1

PDB Entry: 1ndh, 2.1 Å

PDB Description: crystal structure of nadh-cytochrome b5 reductase from pig liver at 2.4 angstroms resolution

SCOP Domain Sequences for d1ndh_1:

Sequence; same for both SEQRES and ATOM records:

>d1ndh_1 b.43.4.2 (3-125) cytochrome b5 reductase {Pig (Sus scrofa), liver}
paitlenpdikyplrlidkevvnhdtrrfrfalpspehilglpvgqhiylsaridgnlvi
rpytpvssdddkgfvdlvikvyfkdthpkfpaggkmsqylesmkigdtiefrgpngllvy
qgk

Timeline for d1ndh_1:

• d1ndh_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ndh_1 appears in SCOP 1.69
  
• d1ndh_1 is called d1ndha1 in SCOP 1.73
  
• d1ndh_1 appears in the current release, SCOPe 2.08, called d1ndha1