Lineage for d1ndh_1 (1ndh 3-125)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies) 
Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) 
Family b.43.1.1: Reductases [50414] (4 proteins) 
Protein cytochrome b5 reductase [50427] (1 species) Species Pig (Sus scrofa), liver [TaxId:9823] [50428] (1 PDB entry) 
Domain d1ndh_1: 1ndh 3-125 [25662]
Other proteins in same PDB: d1ndh_2
Details for d1ndh_1
PDB Entry: 1ndh (more details), 2.1 Å
PDB Description: crystal structure of nadh-cytochrome b5 reductase from pig liver at 2.4 angstroms resolution
SCOP Domain Sequences for d1ndh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndh_1 b.43.1.1 (3-125) cytochrome b5 reductase {Pig (Sus scrofa), liver}
paitlenpdikyplrlidkevvnhdtrrfrfalpspehilglpvgqhiylsaridgnlvi
rpytpvssdddkgfvdlvikvyfkdthpkfpaggkmsqylesmkigdtiefrgpngllvy
qgk
SCOP Domain Coordinates for d1ndh_1:
Click to download the PDB-style file with coordinates for d1ndh_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ndh_1:
- d1ndh_1 appears in SCOP 1.57
- d1ndh_1 appears in the current release, SCOPe 2.07, called d1ndha1
View in 3D
