Lineage for d4civa_ (4civ A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839588Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1839589Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 1839590Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 1839637Species Mycobacterium tuberculosis [TaxId:1773] [52307] (16 PDB entries)
  8. 1839653Domain d4civa_: 4civ A: [256618]
    automated match to d1h05a_
    complexed with 48p

Details for d4civa_

PDB Entry: 4civ (more details), 2.9 Å

PDB Description: crystal structure of mycobacterium tuberculosis type 2 dehydroquinase in complex with (1r,4r,5r)-1,4,5-trihydroxy-3-hydroxymethylcyclohex- 2-ene-1-carboxylic acid
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4civa_:

Sequence, based on SEQRES records: (download)

>d4civa_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaehv

Sequence, based on observed residues (ATOM records): (download)

>d4civa_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaad
aaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivg
lgiqgyllalrylaehv

SCOPe Domain Coordinates for d4civa_:

Click to download the PDB-style file with coordinates for d4civa_.
(The format of our PDB-style files is described here.)

Timeline for d4civa_: