Lineage for d1cne_1 (1cne 11-124)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies) 
Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) 
Family b.43.1.1: Reductases [50414] (4 proteins) 
Protein Nitrate reductase core domain [50425] (1 species) Species Corn (Zea mays) [TaxId:4577] [50426] (3 PDB entries) 
Domain d1cne_1: 1cne 11-124 [25661]
Other proteins in same PDB: d1cne_2
Details for d1cne_1
PDB Entry: 1cne (more details), 3 Å
PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain
SCOP Domain Sequences for d1cne_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cne_1 b.43.1.1 (11-124) Nitrate reductase core domain {Corn (Zea mays)}
grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv
deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgr
SCOP Domain Coordinates for d1cne_1:
Click to download the PDB-style file with coordinates for d1cne_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cne_1:
- d1cne_1 appears in SCOP 1.57
- d1cne_1 appears in the current release, SCOPe 2.08, called d1cnea1
View in 3D
