SCOPe 2.08: Domain d1cnea1: 1cne A:11-124

Lineage for d1cnea1 (1cne A:11-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Nitrate reductase core domain [50425] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [50426] (3 PDB entries)

8. Domain d1cnea1: 1cne A:11-124 [25661]
   Other proteins in same PDB: d1cnea2
   complexed with fad; mutant

Details for d1cnea1

PDB Entry: 1cne, 3 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain

PDB Compounds: (A:) nitrate reductase

SCOPe Domain Sequences for d1cnea1:

Sequence; same for both SEQRES and ATOM records:

>d1cnea1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Maize (Zea mays) [TaxId: 4577]}
grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv
deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgr

Timeline for d1cnea1:

• d1cnea1 first appeared (with stable ids) in SCOP 1.55, called d1cne_1
  
• d1cnea1 appears in SCOPe 2.07