SCOPe 2.06: Domain d4cfqa_: 4cfq A:

Lineage for d4cfqa_ (4cfq A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (42 PDB entries)

8. Domain d4cfqa_: 4cfq A: [256604]
   automated match to d2rgia_
   complexed with ca

Details for d4cfqa_

PDB Entry: 4cfq, 1.37 Å

PDB Description: ca-bound truncated (delta13c) and c3s, c81s and c86s mutated s100a4 complexed with non-muscle myosin iia

PDB Compounds: (A:) Protein S100-A4

SCOPe Domain Sequences for d4cfqa_:

Sequence, based on SEQRES records:

>d4cfqa_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
masplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklms
nldsnrdnevdfqeycvflssiammsn

Sequence, based on observed residues (ATOM records):

>d4cfqa_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
masplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgtdeaafqklmsnl
dsnrdnevdfqeycvflssiammsn

Timeline for d4cfqa_:

• d4cfqa_ first appeared in SCOPe 2.04
  
• d4cfqa_ appears in SCOPe 2.05
  
• d4cfqa_ appears in SCOPe 2.07
  
• d4cfqa_ appears in the current release, SCOPe 2.08