Lineage for d4cdya_ (4cdy A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312848Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2313134Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2313135Protein Cytochrome c' [47180] (9 species)
  7. 2313138Species Alcaligenes sp. [TaxId:512] [47184] (13 PDB entries)
  8. 2313148Domain d4cdya_: 4cdy A: [256603]
    automated match to d1e83a_
    complexed with hec

Details for d4cdya_

PDB Entry: 4cdy (more details), 1.77 Å

PDB Description: spectroscopically-validated structure of cytochrome c prime from alcaligenes xylosoxidans, reduced by x-ray irradiation at 160k
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d4cdya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cdya_ a.24.3.2 (A:) Cytochrome c' {Alcaligenes sp. [TaxId: 512]}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkk

SCOPe Domain Coordinates for d4cdya_:

Click to download the PDB-style file with coordinates for d4cdya_.
(The format of our PDB-style files is described here.)

Timeline for d4cdya_: