SCOPe 2.08: Domain d4cc6a_: 4cc6 A:

Lineage for d4cc6a_ (4cc6 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families)
   has a circularly permuted topology

5. Family d.142.2.0: automated matches [227263] (1 protein)
   not a true family

6. Protein automated matches [227054] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [256598] (2 PDB entries)

8. Domain d4cc6a_: 4cc6 A: [256600]
   automated match to d3uq8a_
   complexed with l5y, so4

Details for d4cc6a_

PDB Entry: 4cc6, 2.01 Å

PDB Description: Fragment-Based Discovery of 6 Azaindazoles As Inhibitors of Bacterial DNA Ligase

PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d4cc6a_:

Sequence; same for both SEQRES and ATOM records:

>d4cc6a_ d.142.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
adlssrvnelhdllnqysyeyyvednpsvpdseydkllhelikieeehpeyktvdsptvr
vggeaqasfnkvnhdtpmlslgnafneddlrkfdqrireqignveymcelkidglavslk
yvdgyfvqgltrgdgttgeditenlktihaiplkmkeplnvevrgeaymprrsflrlnee
kekndeqlfanprnaaagslrqldskltakrklsvfiysvndftdfnarsqsealdeldk
lgfttnknrarvnnidgvleyiekwtsqreslpydidgivikvndldqqdemgftqkspr
waiaykfp

Timeline for d4cc6a_:

• d4cc6a_ first appeared in SCOPe 2.04
  
• d4cc6a_ appears in SCOPe 2.07