Lineage for d1cnfa1 (1cnf A:11-124)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063096Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2063153Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2063254Protein Nitrate reductase core domain [50425] (1 species)
  7. 2063255Species Maize (Zea mays) [TaxId:4577] [50426] (3 PDB entries)
  8. 2063257Domain d1cnfa1: 1cnf A:11-124 [25660]
    Other proteins in same PDB: d1cnfa2
    complexed with adp, fad; mutant

Details for d1cnfa1

PDB Entry: 1cnf (more details), 2.7 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain
PDB Compounds: (A:) nitrate reductase

SCOPe Domain Sequences for d1cnfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnfa1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Maize (Zea mays) [TaxId: 4577]}
grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv
deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgr

SCOPe Domain Coordinates for d1cnfa1:

Click to download the PDB-style file with coordinates for d1cnfa1.
(The format of our PDB-style files is described here.)

Timeline for d1cnfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cnfa2