Lineage for d1cnf_1 (1cnf 11-124)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60149Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 60166Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 60227Protein Nitrate reductase core domain [50425] (1 species)
  7. 60228Species Corn (Zea mays) [TaxId:4577] [50426] (3 PDB entries)
  8. 60230Domain d1cnf_1: 1cnf 11-124 [25660]
    Other proteins in same PDB: d1cnf_2

Details for d1cnf_1

PDB Entry: 1cnf (more details), 2.7 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain

SCOP Domain Sequences for d1cnf_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnf_1 b.43.4.2 (11-124) Nitrate reductase core domain {Corn (Zea mays)}
grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv
deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgr

SCOP Domain Coordinates for d1cnf_1:

Click to download the PDB-style file with coordinates for d1cnf_1.
(The format of our PDB-style files is described here.)

Timeline for d1cnf_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cnf_2