![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (49 species) not a true protein |
![]() | Species Plasmodium berghei [TaxId:5821] [256595] (1 PDB entry) |
![]() | Domain d4cbxa1: 4cbx A:5-146 [256596] Other proteins in same PDB: d4cbxg_ automated match to d1c0fa1 complexed with atp, ca, na, po4, so4 |
PDB Entry: 4cbx (more details), 2.2 Å
SCOPe Domain Sequences for d4cbxa1:
Sequence, based on SEQRES records: (download)
>d4cbxa1 c.55.1.0 (A:5-146) automated matches {Plasmodium berghei [TaxId: 5821]} sialvvdngsgmvksglagddapkcvfpsiigipkmpnimvgmeqkecyvgdeaqnkrgi ltlkypiehgivtnwddmekiwrhtffnelrvspeehpvllteaplnpktnrekmtqimf esfdvpamyvsiqailslyasg
>d4cbxa1 c.55.1.0 (A:5-146) automated matches {Plasmodium berghei [TaxId: 5821]} sialvvdngsgmvksglagddapkcvfpsiigipkecyvgdeaqnkrgiltlkypiehgi vtnwddmekiwrhtffnelrvspeehpvllteaplnpktnrekmtqimfesfdvpamyvs iqailslyasg
Timeline for d4cbxa1: