SCOPe 2.07: Domain d4cbua2: 4cbu A:148-368

Lineage for d4cbua2 (4cbu A:148-368)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [256593] (1 PDB entry)

8. Domain d4cbua2: 4cbu A:148-368 [256594]
   Other proteins in same PDB: d4cbua1, d4cbug_
   automated match to d3ub5a2
   complexed with atp, ca

Details for d4cbua2

PDB Entry: 4cbu, 1.3 Å

PDB Description: Crystal structure of Plasmodium falciparum actin I

PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d4cbua2:

Sequence; same for both SEQRES and ATOM records:

>d4cbua2 c.55.1.1 (A:148-368) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
rttgivldsgdgvshtvpiyegyalphaimrldlagrdlteylmkilhergygfstsaek
eivrdikeklcyialnfdeemktseqssdieksyelpdgniitvgnerfrcpealfqpsf
lgkeaagihtttfnsikkcdvdirkdlygnivlsggttmyegigerltrdittlapstmk
ikvvapperkysvwiggsilsslstfqqmwitkeeydesgp

Timeline for d4cbua2:

• d4cbua2 first appeared in SCOPe 2.04
  
• d4cbua2 appears in SCOPe 2.06
  
• d4cbua2 appears in the current release, SCOPe 2.08