Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
Protein automated matches [226883] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries) |
Domain d4cbug_: 4cbu G: [256590] Other proteins in same PDB: d4cbua1, d4cbua2 automated match to d3cipg_ complexed with atp, ca |
PDB Entry: 4cbu (more details), 1.3 Å
SCOPe Domain Sequences for d4cbug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cbug_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mvvehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngnlqyd lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkgg vasgf
Timeline for d4cbug_: