SCOP 1.73: Domain d2cnda1: 2cnd A:11-124

Lineage for d2cnda1 (2cnd A:11-124)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Nitrate reductase core domain [50425] (1 species)

7. Species Corn (Zea mays) [TaxId:4577] [50426] (3 PDB entries)

8. Domain d2cnda1: 2cnd A:11-124 [25659]
   Other proteins in same PDB: d2cnda2
   complexed with fad

Details for d2cnda1

PDB Entry: 2cnd, 2.5 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain

PDB Compounds: (A:) nadh-dependent nitrate reductase

SCOP Domain Sequences for d2cnda1:

Sequence; same for both SEQRES and ATOM records:

>d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]}
grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv
deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgr

Timeline for d2cnda1:

• d2cnda1 first appeared (with stable ids) in SCOP 1.55, called d2cnd_1
  
• d2cnda1 was called d2cnd_1 in SCOP 1.71
  
• d2cnda1 appears in SCOP 1.75
  
• d2cnda1 appears in the current release, SCOPe 2.08