Class b: All beta proteins [48724] (165 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Nitrate reductase core domain [50425] (1 species) |
Species Corn (Zea mays) [TaxId:4577] [50426] (3 PDB entries) |
Domain d2cnda1: 2cnd A:11-124 [25659] Other proteins in same PDB: d2cnda2 complexed with fad |
PDB Entry: 2cnd (more details), 2.5 Å
SCOP Domain Sequences for d2cnda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]} grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgr
Timeline for d2cnda1: