SCOP 1.59: Domain d2cnd_1: 2cnd 11-124

Lineage for d2cnd_1 (2cnd 11-124)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)

6. Protein Nitrate reductase core domain [50425] (1 species)

7. Species Corn (Zea mays) [TaxId:4577] [50426] (3 PDB entries)

8. Domain d2cnd_1: 2cnd 11-124 [25659]
   Other proteins in same PDB: d2cnd_2

Details for d2cnd_1

PDB Entry: 2cnd, 2.5 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain

SCOP Domain Sequences for d2cnd_1:

Sequence; same for both SEQRES and ATOM records:

>d2cnd_1 b.43.4.2 (11-124) Nitrate reductase core domain {Corn (Zea mays)}
grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv
deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgr

Timeline for d2cnd_1:

• d2cnd_1 first appeared (with stable ids) in SCOP 1.55
  
• d2cnd_1 appears in SCOP 1.57
  
• d2cnd_1 appears in SCOP 1.61
  
• d2cnd_1 appears in the current release, SCOPe 2.08, called d2cnda1