Lineage for d2cnd_1 (2cnd 11-124)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14603Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) (S)
  5. 14604Family b.43.1.1: Reductases [50414] (4 proteins)
  6. 14651Protein Nitrate reductase core domain [50425] (1 species)
  7. 14652Species Corn (Zea mays) [TaxId:4577] [50426] (3 PDB entries)
  8. 14653Domain d2cnd_1: 2cnd 11-124 [25659]
    Other proteins in same PDB: d2cnd_2

Details for d2cnd_1

PDB Entry: 2cnd (more details), 2.5 Å

PDB Description: structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain

SCOP Domain Sequences for d2cnd_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cnd_1 b.43.1.1 (11-124) Nitrate reductase core domain {Corn (Zea mays)}
grihcrlvakkelsrdvrlfrfslpspdqvlglpigkhifvcatiegklcmraytptsmv
deighfdllvkvyfknehpkfpngglmtqyldslpvgsyidvkgplghveytgr

SCOP Domain Coordinates for d2cnd_1:

Click to download the PDB-style file with coordinates for d2cnd_1.
(The format of our PDB-style files is described here.)

Timeline for d2cnd_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cnd_2