Lineage for d4c3ra_ (4c3r A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1929306Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 1929307Species Human (Homo sapiens) [TaxId:9606] [90039] (46 PDB entries)
  8. 1929364Domain d4c3ra_: 4c3r A: [256585]
    automated match to d1ol5a_
    complexed with acp

Details for d4c3ra_

PDB Entry: 4c3r (more details), 2.79 Å

PDB Description: structure of dephosphorylated aurora a (122-403) bound to amppcp
PDB Compounds: (A:) Aurora kinase A

SCOPe Domain Sequences for d4c3ra_:

Sequence, based on SEQRES records: (download)

>d4c3ra_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
chskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmh
dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh
npsqrpmlrevlehpwitanss

Sequence, based on observed residues (ATOM records): (download)

>d4c3ra_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
chskrvihrdikpenlllgsagelkiadfgwsvhgtldylppemiegrmhdekvdlwslg
vlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlre
vlehpwitanss

SCOPe Domain Coordinates for d4c3ra_:

Click to download the PDB-style file with coordinates for d4c3ra_.
(The format of our PDB-style files is described here.)

Timeline for d4c3ra_: