Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (21 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [187205] (3 PDB entries) |
Domain d4byaa1: 4bya A:3-71 [256580] Other proteins in same PDB: d4byaa2, d4byaa3 automated match to d1cmga_ complexed with ca; mutant |
PDB Entry: 4bya (more details)
SCOPe Domain Sequences for d4byaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4byaa1 a.39.1.5 (A:3-71) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} mkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgq vnyeefvqh
Timeline for d4byaa1: