SCOPe 2.06: Domain d4byaa1: 4bya A:3-71

Lineage for d4byaa1 (4bya A:3-71)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [187205] (3 PDB entries)

8. Domain d4byaa1: 4bya A:3-71 [256580]
   Other proteins in same PDB: d4byaa2, d4byaa3
   automated match to d1cmga_
   complexed with ca; mutant

Details for d4byaa1

PDB Entry: 4bya

PDB Description: calmodulin, c-terminal domain, m144h mutant

PDB Compounds: (A:) calmodulin, c-terminal domain, m144h mutant

SCOPe Domain Sequences for d4byaa1:

Sequence; same for both SEQRES and ATOM records:

>d4byaa1 a.39.1.5 (A:3-71) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgq
vnyeefvqh

Timeline for d4byaa1:

• d4byaa1 first appeared in SCOPe 2.04, called d4byaa_
  
• d4byaa1 was called d4byaa_ in SCOPe 2.05
  
• d4byaa1 appears in SCOPe 2.07
  
• d4byaa1 appears in the current release, SCOPe 2.08