SCOPe 2.06: Domain d4bwwb_: 4bww B:

Lineage for d4bwwb_ (4bww B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein automated matches [190545] (8 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256578] (1 PDB entry)

8. Domain d4bwwb_: 4bww B: [256579]
   automated match to d1jzga_
   complexed with cu, gol, no3, so4

Details for d4bwwb_

PDB Entry: 4bww, 1.48 Å

PDB Description: Crystal structure of spin labelled azurin T21R1.

PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d4bwwb_:

Sequence; same for both SEQRES and ATOM records:

>d4bwwb_ b.6.1.1 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
aecsvdiqgndqmqfntnaicvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Timeline for d4bwwb_:

• d4bwwb_ first appeared in SCOPe 2.04
  
• d4bwwb_ appears in SCOPe 2.05
  
• d4bwwb_ appears in SCOPe 2.07
  
• d4bwwb_ appears in the current release, SCOPe 2.08