SCOPe 2.07: Domain d4bpga1: 4bpg A:1-78

Lineage for d4bpga1 (4bpg A:1-78)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (28 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [256569] (3 PDB entries)

8. Domain d4bpga1: 4bpg A:1-78 [256571]
   Other proteins in same PDB: d4bpga2, d4bpgb2
   automated match to d1hqba_

Details for d4bpga1

PDB Entry: 4bpg, 2.2 Å

PDB Description: crystal structure of bacillus subtilis dltc

PDB Compounds: (A:) d-alanine--poly(phosphoribitol) ligase subunit 2

SCOPe Domain Sequences for d4bpga1:

Sequence; same for both SEQRES and ATOM records:

>d4bpga1 a.28.1.0 (A:1-78) automated matches {Bacillus subtilis [TaxId: 1423]}
mdfkqevldvlaevcqddivkenpdieifeeglldsfgtvelllaienrfdilvpitefd
rdvwntpnnivnqlselk

Timeline for d4bpga1:

• d4bpga1 first appeared in SCOPe 2.04, called d4bpga_
  
• d4bpga1 appears in SCOPe 2.06
  
• d4bpga1 appears in the current release, SCOPe 2.08