Lineage for d4bpga1 (4bpg A:1-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706255Species Bacillus subtilis [TaxId:1423] [256569] (3 PDB entries)
  8. 2706258Domain d4bpga1: 4bpg A:1-78 [256571]
    Other proteins in same PDB: d4bpga2, d4bpgb2
    automated match to d1hqba_

Details for d4bpga1

PDB Entry: 4bpg (more details), 2.2 Å

PDB Description: crystal structure of bacillus subtilis dltc
PDB Compounds: (A:) d-alanine--poly(phosphoribitol) ligase subunit 2

SCOPe Domain Sequences for d4bpga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bpga1 a.28.1.0 (A:1-78) automated matches {Bacillus subtilis [TaxId: 1423]}
mdfkqevldvlaevcqddivkenpdieifeeglldsfgtvelllaienrfdilvpitefd
rdvwntpnnivnqlselk

SCOPe Domain Coordinates for d4bpga1:

Click to download the PDB-style file with coordinates for d4bpga1.
(The format of our PDB-style files is described here.)

Timeline for d4bpga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bpga2