![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
![]() | Protein automated matches [191038] (29 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [256569] (3 PDB entries) |
![]() | Domain d4bpga1: 4bpg A:1-78 [256571] Other proteins in same PDB: d4bpga2, d4bpgb2 automated match to d1hqba_ |
PDB Entry: 4bpg (more details), 2.2 Å
SCOPe Domain Sequences for d4bpga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bpga1 a.28.1.0 (A:1-78) automated matches {Bacillus subtilis [TaxId: 1423]} mdfkqevldvlaevcqddivkenpdieifeeglldsfgtvelllaienrfdilvpitefd rdvwntpnnivnqlselk
Timeline for d4bpga1: