Lineage for d4bmma1 (4bmm A:32-477)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005980Species Trypanosoma cruzi [TaxId:353153] [256563] (1 PDB entry)
  8. 2005981Domain d4bmma1: 4bmm A:32-477 [256564]
    Other proteins in same PDB: d4bmma2, d4bmmb2, d4bmmc2, d4bmmd2
    automated match to d3khma_
    complexed with hem, tu1

Details for d4bmma1

PDB Entry: 4bmm (more details), 2.84 Å

PDB Description: Crystal structure of Trypanosoma cruzi CYP51 bound to the inhibitor (R)-N-(3-(1H-indol-3-yl)-1-oxo-1-(pyridin-4-ylamino)propan-2-yl)-2',3, 5'-trifluoro-(1,1'-biphenyl)-4-carboxamide
PDB Compounds: (A:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d4bmma1:

Sequence, based on SEQRES records: (download)

>d4bmma1 a.104.1.0 (A:32-477) automated matches {Trypanosoma cruzi [TaxId: 353153]}
ppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrffs
prneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslipa
avfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkavyr
dgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqln
ydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhde
eafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrde
vpdpdyhtmvvgptlnqclvkytrkk

Sequence, based on observed residues (ATOM records): (download)

>d4bmma1 a.104.1.0 (A:32-477) automated matches {Trypanosoma cruzi [TaxId: 353153]}
ppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrffs
prneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslipa
avfmpwllrlplpqsarcrearaelqkilgeiivarekeesdllggllkavyrdgtrmsl
hevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlnydnvmde
mpfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdeeafpnpr
lwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdevpdpdyh
tmvvgptlnqclvkytrkk

SCOPe Domain Coordinates for d4bmma1:

Click to download the PDB-style file with coordinates for d4bmma1.
(The format of our PDB-style files is described here.)

Timeline for d4bmma1: