Lineage for d1qfjb1 (1qfj B:1-97)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801523Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 801545Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 801633Protein NAD(P)H:flavin oxidoreductase [50423] (1 species)
  7. 801634Species Escherichia coli [TaxId:562] [50424] (1 PDB entry)
  8. 801636Domain d1qfjb1: 1qfj B:1-97 [25656]
    Other proteins in same PDB: d1qfja2, d1qfjb2, d1qfjc2, d1qfjd2
    CASP3

Details for d1qfjb1

PDB Entry: 1qfj (more details), 2.2 Å

PDB Description: crystal structure of nad(p)h:flavin oxidoreductase from escherichia coli
PDB Compounds: (B:) protein (flavin reductase)

SCOP Domain Sequences for d1qfjb1:

Sequence, based on SEQRES records: (download)

>d1qfjb1 b.43.4.2 (B:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]}
ttlsckvtsveaitdtvyrvrivpdaafsfragqylmvvmderdkrpfsmastpdekgfi
elhigaseinlyakavmdrilkdhqivvdiphgeawl

Sequence, based on observed residues (ATOM records): (download)

>d1qfjb1 b.43.4.2 (B:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]}
ttlsckvtsveaitdtvyrvrivpdaafsfragqylmvvmderdkrpfsmastpdekgfi
elhigyakavmdrilkdhqivvdiphgeawl

SCOP Domain Coordinates for d1qfjb1:

Click to download the PDB-style file with coordinates for d1qfjb1.
(The format of our PDB-style files is described here.)

Timeline for d1qfjb1: