Lineage for d1qfjb1 (1qfj B:1-97)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14603Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) (S)
  5. 14604Family b.43.1.1: Reductases [50414] (4 protein domains)
  6. 14645Protein NAD(P)H:flavin oxidoreductase [50423] (1 species)
  7. 14646Species Escherichia coli [TaxId:562] [50424] (1 PDB entry)
  8. 14648Domain d1qfjb1: 1qfj B:1-97 [25656]
    Other proteins in same PDB: d1qfja2, d1qfjb2, d1qfjc2, d1qfjd2

Details for d1qfjb1

PDB Entry: 1qfj (more details), 2.2 Å

PDB Description: crystal structure of nad(p)h:flavin oxidoreductase from escherichia coli

SCOP Domain Sequences for d1qfjb1:

Sequence, based on SEQRES records: (download)

>d1qfjb1 b.43.1.1 (B:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli}
ttlsckvtsveaitdtvyrvrivpdaafsfragqylmvvmderdkrpfsmastpdekgfi
elhigaseinlyakavmdrilkdhqivvdiphgeawl

Sequence, based on observed residues (ATOM records): (download)

>d1qfjb1 b.43.1.1 (B:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli}
ttlsckvtsveaitdtvyrvrivpdaafsfragqylmvvmderdkrpfsmastpdekgfi
elhigyakavmdrilkdhqivvdiphgeawl

SCOP Domain Coordinates for d1qfjb1:

Click to download the PDB-style file with coordinates for d1qfjb1.
(The format of our PDB-style files is described here.)

Timeline for d1qfjb1: