Lineage for d1qfjb1 (1qfj B:1-97)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793526Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2793621Protein NAD(P)H:flavin oxidoreductase [50423] (1 species)
  7. 2793622Species Escherichia coli [TaxId:562] [50424] (1 PDB entry)
  8. 2793624Domain d1qfjb1: 1qfj B:1-97 [25656]
    Other proteins in same PDB: d1qfja2, d1qfjb2, d1qfjc2, d1qfjd2
    CASP3
    complexed with gol

Details for d1qfjb1

PDB Entry: 1qfj (more details), 2.2 Å

PDB Description: crystal structure of nad(p)h:flavin oxidoreductase from escherichia coli
PDB Compounds: (B:) protein (flavin reductase)

SCOPe Domain Sequences for d1qfjb1:

Sequence, based on SEQRES records: (download)

>d1qfjb1 b.43.4.2 (B:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]}
ttlsckvtsveaitdtvyrvrivpdaafsfragqylmvvmderdkrpfsmastpdekgfi
elhigaseinlyakavmdrilkdhqivvdiphgeawl

Sequence, based on observed residues (ATOM records): (download)

>d1qfjb1 b.43.4.2 (B:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]}
ttlsckvtsveaitdtvyrvrivpdaafsfragqylmvvmderdkrpfsmastpdekgfi
elhigyakavmdrilkdhqivvdiphgeawl

SCOPe Domain Coordinates for d1qfjb1:

Click to download the PDB-style file with coordinates for d1qfjb1.
(The format of our PDB-style files is described here.)

Timeline for d1qfjb1: