| Class b: All beta proteins [48724] (180 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
| Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
| Protein NAD(P)H:flavin oxidoreductase [50423] (1 species) |
| Species Escherichia coli [TaxId:562] [50424] (1 PDB entry) |
| Domain d1qfjb1: 1qfj B:1-97 [25656] Other proteins in same PDB: d1qfja2, d1qfjb2, d1qfjc2, d1qfjd2 CASP3 complexed with gol |
PDB Entry: 1qfj (more details), 2.2 Å
SCOPe Domain Sequences for d1qfjb1:
Sequence, based on SEQRES records: (download)
>d1qfjb1 b.43.4.2 (B:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]}
ttlsckvtsveaitdtvyrvrivpdaafsfragqylmvvmderdkrpfsmastpdekgfi
elhigaseinlyakavmdrilkdhqivvdiphgeawl
>d1qfjb1 b.43.4.2 (B:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]}
ttlsckvtsveaitdtvyrvrivpdaafsfragqylmvvmderdkrpfsmastpdekgfi
elhigyakavmdrilkdhqivvdiphgeawl
Timeline for d1qfjb1: