Lineage for d4bl3a3 (4bl3 A:328-668)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619196Protein automated matches [190161] (30 species)
    not a true protein
  7. 2619561Species Staphylococcus aureus [TaxId:1280] [189852] (11 PDB entries)
  8. 2619582Domain d4bl3a3: 4bl3 A:328-668 [256559]
    Other proteins in same PDB: d4bl3a1, d4bl3a2, d4bl3b1, d4bl3b2
    automated match to d1vqqa3
    complexed with cd, cl, mur; mutant

Details for d4bl3a3

PDB Entry: 4bl3 (more details), 3 Å

PDB Description: crystal structure of pbp2a clinical mutant n146k from mrsa
PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d4bl3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bl3a3 e.3.1.1 (A:328-668) automated matches {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgrqigwfisydkdnpnmmma
invkdvqdkgmasynakisgkvydelyengnkkydide

SCOPe Domain Coordinates for d4bl3a3:

Click to download the PDB-style file with coordinates for d4bl3a3.
(The format of our PDB-style files is described here.)

Timeline for d4bl3a3: