Lineage for d4bl3a1 (4bl3 A:26-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937302Species Staphylococcus aureus [TaxId:1280] [256158] (3 PDB entries)
  8. 2937305Domain d4bl3a1: 4bl3 A:26-138 [256557]
    Other proteins in same PDB: d4bl3a2, d4bl3a3, d4bl3b2, d4bl3b3
    automated match to d1vqqa1
    complexed with cd, cl, mur; mutant

Details for d4bl3a1

PDB Entry: 4bl3 (more details), 3 Å

PDB Description: crystal structure of pbp2a clinical mutant n146k from mrsa
PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d4bl3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bl3a1 d.17.4.0 (A:26-138) automated matches {Staphylococcus aureus [TaxId: 1280]}
kdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrki
kkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOPe Domain Coordinates for d4bl3a1:

Click to download the PDB-style file with coordinates for d4bl3a1.
(The format of our PDB-style files is described here.)

Timeline for d4bl3a1: