SCOPe 2.08: Domain d4bl2b2: 4bl2 B:139-327

Lineage for d4bl2b2 (4bl2 B:139-327)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (13 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [256159] (3 PDB entries)

8. Domain d4bl2b2: 4bl2 B:139-327 [256555]
   Other proteins in same PDB: d4bl2a1, d4bl2a3, d4bl2b1, d4bl2b3
   automated match to d1vqqa2
   complexed with cd, cl; mutant

Details for d4bl2b2

PDB Entry: 4bl2, 2.72 Å

PDB Description: crystal structure of pbp2a clinical mutant e150k from mrsa

PDB Compounds: (B:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d4bl2b2:

Sequence; same for both SEQRES and ATOM records:

>d4bl2b2 d.175.1.0 (B:139-327) automated matches {Staphylococcus aureus [TaxId: 1280]}
dqsihienlkskrgkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d4bl2b2:

• d4bl2b2 first appeared in SCOPe 2.04
  
• d4bl2b2 appears in SCOPe 2.07