Lineage for d4bl2b2 (4bl2 B:139-327)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004489Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 3004490Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 3004526Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 3004527Protein automated matches [226981] (13 species)
    not a true protein
  7. 3004591Species Staphylococcus aureus [TaxId:1280] [256159] (3 PDB entries)
  8. 3004597Domain d4bl2b2: 4bl2 B:139-327 [256555]
    Other proteins in same PDB: d4bl2a1, d4bl2a3, d4bl2b1, d4bl2b3
    automated match to d1vqqa2
    complexed with cd, cl; mutant

Details for d4bl2b2

PDB Entry: 4bl2 (more details), 2.72 Å

PDB Description: crystal structure of pbp2a clinical mutant e150k from mrsa
PDB Compounds: (B:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d4bl2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bl2b2 d.175.1.0 (B:139-327) automated matches {Staphylococcus aureus [TaxId: 1280]}
dqsihienlkskrgkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

SCOPe Domain Coordinates for d4bl2b2:

Click to download the PDB-style file with coordinates for d4bl2b2.
(The format of our PDB-style files is described here.)

Timeline for d4bl2b2: