![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
![]() | Protein automated matches [190205] (33 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [256158] (3 PDB entries) |
![]() | Domain d4bl2a1: 4bl2 A:26-138 [256551] Other proteins in same PDB: d4bl2a2, d4bl2a3, d4bl2b2, d4bl2b3 automated match to d1vqqa1 complexed with cd, cl; mutant |
PDB Entry: 4bl2 (more details), 2.72 Å
SCOPe Domain Sequences for d4bl2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bl2a1 d.17.4.0 (A:26-138) automated matches {Staphylococcus aureus [TaxId: 1280]} kdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrki kkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
Timeline for d4bl2a1: