Lineage for d4bkha_ (4bkh A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.135: Tetraspanin [48651] (1 superfamily)
5 helices: irregular disulfide-linked array; form homodimerSuperfamily a.135.1: Tetraspanin [48652] (1 family) 
Family a.135.1.1: Tetraspanin [48653] (2 proteins) Protein automated matches [256548] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [256549] (6 PDB entries) 
Domain d4bkha_: 4bkh A: [256550]
complexed with edo, mla
complexed with edo, mla
Details for d4bkha_
PDB Entry: 4bkh (more details), 1.4 Å
PDB Description: Multiple LEL structures
PDB Compounds: (A:) CD81 antigenSCOPe Domain Sequences for d4bkha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bkha_ a.135.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etgfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsv
lknnlcpsgsniisnlfkedchqkiddlfsgk
SCOPe Domain Coordinates for d4bkha_:
Click to download the PDB-style file with coordinates for d4bkha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bkha_:
- d4bkha_ first appeared in SCOPe 2.04
- d4bkha_ is called d4bkha1 in SCOPe 2.06
- d4bkha_ appears in the current release, SCOPe 2.08, called d4bkha1
View in 3D
