SCOPe 2.08: Domain d4bkha1: 4bkh A:112-201

Lineage for d4bkha1 (4bkh A:112-201)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.135: Tetraspanin [48651] (1 superfamily)
   5 helices: irregular disulfide-linked array; form homodimer

4. Superfamily a.135.1: Tetraspanin [48652] (1 family)

5. Family a.135.1.1: Tetraspanin [48653] (2 proteins)

6. Protein automated matches [256548] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries)

8. Domain d4bkha1: 4bkh A:112-201 [256550]
   Other proteins in same PDB: d4bkha2
   complexed with edo, mla
   complexed with edo, mla

Details for d4bkha1

PDB Entry: 4bkh, 1.4 Å

PDB Description: Multiple LEL structures

PDB Compounds: (A:) CD81 antigen

SCOPe Domain Sequences for d4bkha1:

Sequence; same for both SEQRES and ATOM records:

>d4bkha1 a.135.1.1 (A:112-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlk
nnlcpsgsniisnlfkedchqkiddlfsgk

Timeline for d4bkha1:

• d4bkha1 first appeared in SCOPe 2.04, called d4bkha_
  
• d4bkha1 appears in SCOPe 2.07