SCOPe 2.08: Domain d4bj0a1: 4bj0 A:2-166

Lineage for d4bj0a1 (4bj0 A:2-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.14: CBM4/9 [74893] (4 proteins)

6. Protein automated matches [191099] (1 species)
   not a true protein

7. Species Rhodothermus marinus [TaxId:29549] [189091] (9 PDB entries)

8. Domain d4bj0a1: 4bj0 A:2-166 [256544]
   Other proteins in same PDB: d4bj0a2
   automated match to d2y6ha_
   complexed with ca, glc

Details for d4bj0a1

PDB Entry: 4bj0, 1 Å

PDB Description: xyloglucan binding module (cbm4-2 x2-l110f) in complex with branched xyloses

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d4bj0a1:

Sequence; same for both SEQRES and ATOM records:

>d4bj0a1 b.18.1.14 (A:2-166) automated matches {Rhodothermus marinus [TaxId: 29549]}
lvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavtv
ngvgnnpfniqatalpvnvrpgvtytytiraraeqdgavvsftvgnqsfdeygrlhhqqi
ttewqpftfeftvsdqetvirapihfgyaanvgntiyidglaivd

Timeline for d4bj0a1:

• d4bj0a1 first appeared in SCOPe 2.04, called d4bj0a_
  
• d4bj0a1 appears in SCOPe 2.07