Lineage for d1a8pa1 (1a8p A:2-100)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669704Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 669726Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 669746Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 669747Species Azotobacter vinelandii [TaxId:354] [50422] (1 PDB entry)
  8. 669748Domain d1a8pa1: 1a8p A:2-100 [25654]
    Other proteins in same PDB: d1a8pa2
    complexed with fad

Details for d1a8pa1

PDB Entry: 1a8p (more details), 2 Å

PDB Description: ferredoxin reductase from azotobacter vinelandii
PDB Compounds: (A:) nadph:ferredoxin oxidoreductase

SCOP Domain Sequences for d1a8pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]}
snlnvervlsvhhwndtlfsfkttrnpslrfengqfvmiglevdgrplmraysiaspnye
ehleffsikvqngpltsrlqhlkegdelmvsrkptgtlv

SCOP Domain Coordinates for d1a8pa1:

Click to download the PDB-style file with coordinates for d1a8pa1.
(The format of our PDB-style files is described here.)

Timeline for d1a8pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8pa2