Lineage for d1a8p_1 (1a8p 2-100)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60149Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 60166Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 60175Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 60176Species Azotobacter vinelandii [TaxId:354] [50422] (1 PDB entry)
  8. 60177Domain d1a8p_1: 1a8p 2-100 [25654]
    Other proteins in same PDB: d1a8p_2

Details for d1a8p_1

PDB Entry: 1a8p (more details), 2 Å

PDB Description: ferredoxin reductase from azotobacter vinelandii

SCOP Domain Sequences for d1a8p_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8p_1 b.43.4.2 (2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii}
snlnvervlsvhhwndtlfsfkttrnpslrfengqfvmiglevdgrplmraysiaspnye
ehleffsikvqngpltsrlqhlkegdelmvsrkptgtlv

SCOP Domain Coordinates for d1a8p_1:

Click to download the PDB-style file with coordinates for d1a8p_1.
(The format of our PDB-style files is described here.)

Timeline for d1a8p_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8p_2