Lineage for d3zohd_ (3zoh D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403705Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2403706Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2403847Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 2403879Protein Putative styrene monooxygenase small component [101796] (1 species)
  7. 2403880Species Thermus thermophilus [TaxId:274] [101797] (5 PDB entries)
  8. 2403888Domain d3zohd_: 3zoh D: [256538]
    automated match to d1usca_
    complexed with a2q, fmn

Details for d3zohd_

PDB Entry: 3zoh (more details), 1.65 Å

PDB Description: Crystal structure of FMN-binding protein (YP_005476) from Thermus thermophilus with bound 1-Cyclohex-2-enone
PDB Compounds: (D:) flavoredoxin

SCOPe Domain Sequences for d3zohd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zohd_ b.45.1.2 (D:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

SCOPe Domain Coordinates for d3zohd_:

Click to download the PDB-style file with coordinates for d3zohd_.
(The format of our PDB-style files is described here.)

Timeline for d3zohd_: