Lineage for d3zohc_ (3zoh C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794274Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 2794306Protein Putative styrene monooxygenase small component [101796] (1 species)
  7. 2794307Species Thermus thermophilus [TaxId:274] [101797] (5 PDB entries)
  8. 2794314Domain d3zohc_: 3zoh C: [256537]
    automated match to d1usca_
    complexed with a2q, fmn

Details for d3zohc_

PDB Entry: 3zoh (more details), 1.65 Å

PDB Description: Crystal structure of FMN-binding protein (YP_005476) from Thermus thermophilus with bound 1-Cyclohex-2-enone
PDB Compounds: (C:) flavoredoxin

SCOPe Domain Sequences for d3zohc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zohc_ b.45.1.2 (C:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

SCOPe Domain Coordinates for d3zohc_:

Click to download the PDB-style file with coordinates for d3zohc_.
(The format of our PDB-style files is described here.)

Timeline for d3zohc_: