Class b: All beta proteins [48724] (180 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins) different dimerization mode than in the PNP-oxidase like family |
Protein Putative styrene monooxygenase small component [101796] (1 species) |
Species Thermus thermophilus [TaxId:274] [101797] (5 PDB entries) |
Domain d3zohb_: 3zoh B: [256536] automated match to d1usca_ complexed with a2q, fmn |
PDB Entry: 3zoh (more details), 1.65 Å
SCOPe Domain Sequences for d3zohb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zohb_ b.45.1.2 (B:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]} mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap
Timeline for d3zohb_: