SCOPe 2.04: Domain d3zofb_: 3zof B:

Lineage for d3zofb_ (3zof B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
   different dimerization mode than in the PNP-oxidase like family

6. Protein Putative styrene monooxygenase small component [101796] (1 species)

7. Species Thermus thermophilus [TaxId:274] [101797] (5 PDB entries)

8. Domain d3zofb_: 3zof B: [256534]
   automated match to d1usca_
   complexed with fmn, hqe

Details for d3zofb_

PDB Entry: 3zof, 2.15 Å

PDB Description: Crystal structure of FMN-binding protein (YP_005476) from Thermus thermophilus with bound benzene-1,4-diol

PDB Compounds: (B:) flavoredoxin

SCOPe Domain Sequences for d3zofb_:

Sequence; same for both SEQRES and ATOM records:

>d3zofb_ b.45.1.2 (B:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

Timeline for d3zofb_:

• d3zofb_ is new in SCOPe 2.04-stable
  
• d3zofb_ appears in SCOPe 2.05
  
• d3zofb_ appears in the current release, SCOPe 2.08