Class b: All beta proteins [48724] (180 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins) different dimerization mode than in the PNP-oxidase like family |
Protein Putative styrene monooxygenase small component [101796] (1 species) |
Species Thermus thermophilus [TaxId:274] [101797] (5 PDB entries) |
Domain d3zoeb_: 3zoe B: [256531] automated match to d1usca_ complexed with fmn, hba |
PDB Entry: 3zoe (more details), 1.85 Å
SCOPe Domain Sequences for d3zoeb_:
Sequence, based on SEQRES records: (download)
>d3zoeb_ b.45.1.2 (B:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]} mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap
>d3zoeb_ b.45.1.2 (B:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]} mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel ellevhtfgdhdlfvgrvvavweeeglkgrpkpglallyygkglygrpaeetfap
Timeline for d3zoeb_: