Lineage for d3zoeb_ (3zoe B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794274Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 2794306Protein Putative styrene monooxygenase small component [101796] (1 species)
  7. 2794307Species Thermus thermophilus [TaxId:274] [101797] (5 PDB entries)
  8. 2794317Domain d3zoeb_: 3zoe B: [256531]
    automated match to d1usca_
    complexed with fmn, hba

Details for d3zoeb_

PDB Entry: 3zoe (more details), 1.85 Å

PDB Description: Crystal structure of FMN-binding protein (YP_005476) from Thermus thermophilus with bound p-hydroxybenzaldehyde
PDB Compounds: (B:) flavoredoxin

SCOPe Domain Sequences for d3zoeb_:

Sequence, based on SEQRES records: (download)

>d3zoeb_ b.45.1.2 (B:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

Sequence, based on observed residues (ATOM records): (download)

>d3zoeb_ b.45.1.2 (B:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglkgrpkpglallyygkglygrpaeetfap

SCOPe Domain Coordinates for d3zoeb_:

Click to download the PDB-style file with coordinates for d3zoeb_.
(The format of our PDB-style files is described here.)

Timeline for d3zoeb_: