Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries) |
Domain d3ws9a1: 3ws9 A:449-770 [256520] Other proteins in same PDB: d3ws9a2, d3ws9b2 automated match to d2ourb_ complexed with mg, x4d, zn |
PDB Entry: 3ws9 (more details), 2.99 Å
SCOPe Domain Sequences for d3ws9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ws9a1 a.211.1.0 (A:449-770) automated matches {Human (Homo sapiens) [TaxId: 9606]} sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt epllkacrdnlsqwekvirgee
Timeline for d3ws9a1: