SCOP 1.73: Domain d1ewyb1: 1ewy B:1-141

Lineage for d1ewyb1 (1ewy B:1-141)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (24 PDB entries)

8. Domain d1ewyb1: 1ewy B:1-141 [25652]
   Other proteins in same PDB: d1ewya2, d1ewyb2, d1ewyc_
   complexed with fad, fes

Details for d1ewyb1

PDB Entry: 1ewy, 2.38 Å

PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex

PDB Compounds: (B:) ferredoxin-nadp reductase

SCOP Domain Sequences for d1ewyb1:

Sequence; same for both SEQRES and ATOM records:

>d1ewyb1 b.43.4.2 (B:1-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]}
tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
lthiepgsevkitgpvgkeml

Timeline for d1ewyb1:

• d1ewyb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ewyb1 appears in SCOP 1.71
  
• d1ewyb1 appears in SCOP 1.75
  
• d1ewyb1 appears in the current release, SCOPe 2.08