| Class b: All beta proteins [48724] (119 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) ![]() |
| Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins) coupled with a NADP-binding domain of alpha/beta class |
| Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species) |
| Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (15 PDB entries) |
| Domain d1ewyb1: 1ewy B:1-141 [25652] Other proteins in same PDB: d1ewya2, d1ewyb2, d1ewyc_ complexed with fad, fes |
PDB Entry: 1ewy (more details), 2.38 Å
SCOP Domain Sequences for d1ewyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewyb1 b.43.4.2 (B:1-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119}
tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
lthiepgsevkitgpvgkeml
Timeline for d1ewyb1: