Lineage for d1ewyb1 (1ewy B:1-141)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167557Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 167645Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 167665Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins)
  6. 167681Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 167684Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (13 PDB entries)
  8. 167698Domain d1ewyb1: 1ewy B:1-141 [25652]
    Other proteins in same PDB: d1ewya2, d1ewyb2, d1ewyc_

Details for d1ewyb1

PDB Entry: 1ewy (more details), 2.38 Å

PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex

SCOP Domain Sequences for d1ewyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewyb1 b.43.4.2 (B:1-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119}
tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
lthiepgsevkitgpvgkeml

SCOP Domain Coordinates for d1ewyb1:

Click to download the PDB-style file with coordinates for d1ewyb1.
(The format of our PDB-style files is described here.)

Timeline for d1ewyb1: