Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries) |
Domain d3ws8a1: 3ws8 A:449-770 [256519] Other proteins in same PDB: d3ws8a2, d3ws8b2 automated match to d2ourb_ complexed with mg, x4c, zn |
PDB Entry: 3ws8 (more details), 2.6 Å
SCOPe Domain Sequences for d3ws8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ws8a1 a.211.1.0 (A:449-770) automated matches {Human (Homo sapiens) [TaxId: 9606]} sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt epllkacrdnlsqwekvirgee
Timeline for d3ws8a1: