Lineage for d3wk4a1 (3wk4 A:2-227)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883174Family c.108.1.2: YihX-like [56789] (3 proteins)
    the insertion subdomain is a 4-helical bundle
    automatically mapped to Pfam PF13419
  6. 1883175Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
    has a lipid phosphatase activity
  7. 1883176Species Human (Homo sapiens) [TaxId:9606] [102303] (35 PDB entries)
  8. 1883183Domain d3wk4a1: 3wk4 A:2-227 [256513]
    Other proteins in same PDB: d3wk4a2
    automated match to d1zd3a1
    complexed with mg, po4, s0a

Details for d3wk4a1

PDB Entry: 3wk4 (more details), 2.11 Å

PDB Description: crystal structure of soluble epoxide hydrolase in complex with fragment inhibitor
PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d3wk4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wk4a1 c.108.1.2 (A:2-227) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap

SCOPe Domain Coordinates for d3wk4a1:

Click to download the PDB-style file with coordinates for d3wk4a1.
(The format of our PDB-style files is described here.)

Timeline for d3wk4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wk4a2