Lineage for d3wgda1 (3wgd A:62-170)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134369Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)
  8. 2134590Domain d3wgda1: 3wgd A:62-170 [256510]
    Other proteins in same PDB: d3wgda2, d3wgdb2, d3wgdc2, d3wgdd2, d3wgde2, d3wgdf2, d3wgdg2, d3wgdh2, d3wgdi2
    automated match to d2diza_
    complexed with gol, k, po4

Details for d3wgda1

PDB Entry: 3wgd (more details), 2.5 Å

PDB Description: Crystal structure of ERp46 Trx1
PDB Compounds: (A:) Thioredoxin domain-containing protein 5

SCOPe Domain Sequences for d3wgda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgda1 c.47.1.0 (A:62-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skhlytadmfthgiqsaahfvmffapwcghcqrlqptwndlgdkynsmedakvyvakvdc
tahsdvcsaqgvrgyptlklfkpgqeavkyqgprdfqtlenwmlqtlne

SCOPe Domain Coordinates for d3wgda1:

Click to download the PDB-style file with coordinates for d3wgda1.
(The format of our PDB-style files is described here.)

Timeline for d3wgda1: