Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries) |
Domain d3wgda1: 3wgd A:62-170 [256510] Other proteins in same PDB: d3wgda2, d3wgdb2, d3wgdc2, d3wgdd2, d3wgde2, d3wgdf2, d3wgdg2, d3wgdh2, d3wgdi2 automated match to d2diza_ complexed with gol, k, po4 |
PDB Entry: 3wgd (more details), 2.5 Å
SCOPe Domain Sequences for d3wgda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wgda1 c.47.1.0 (A:62-170) automated matches {Human (Homo sapiens) [TaxId: 9606]} skhlytadmfthgiqsaahfvmffapwcghcqrlqptwndlgdkynsmedakvyvakvdc tahsdvcsaqgvrgyptlklfkpgqeavkyqgprdfqtlenwmlqtlne
Timeline for d3wgda1: