Lineage for d3wg7u_ (3wg7 U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327889Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327890Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2327891Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2327892Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2327893Species Cow (Bos taurus) [TaxId:9913] [47697] (29 PDB entries)
  8. 2327909Domain d3wg7u_: 3wg7 U: [256504]
    Other proteins in same PDB: d3wg7a_, d3wg7b1, d3wg7b2, d3wg7c_, d3wg7d_, d3wg7e_, d3wg7f_, d3wg7g_, d3wg7i_, d3wg7j_, d3wg7k_, d3wg7l_, d3wg7m_, d3wg7n_, d3wg7o1, d3wg7o2, d3wg7p_, d3wg7q_, d3wg7r_, d3wg7s_, d3wg7t_, d3wg7v_, d3wg7w_, d3wg7x_, d3wg7y_, d3wg7z_
    automated match to d1v54h_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d3wg7u_

PDB Entry: 3wg7 (more details), 1.9 Å

PDB Description: a 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d3wg7u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wg7u_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d3wg7u_:

Click to download the PDB-style file with coordinates for d3wg7u_.
(The format of our PDB-style files is described here.)

Timeline for d3wg7u_: