Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81454] (25 PDB entries) |
Domain d3wg7o1: 3wg7 O:1-90 [256497] Other proteins in same PDB: d3wg7a_, d3wg7b2, d3wg7c_, d3wg7d_, d3wg7e_, d3wg7f_, d3wg7g_, d3wg7h_, d3wg7i_, d3wg7j_, d3wg7k_, d3wg7l_, d3wg7m_, d3wg7n_, d3wg7o2, d3wg7p_, d3wg7q_, d3wg7r_, d3wg7s_, d3wg7t_, d3wg7u_, d3wg7v_, d3wg7w_, d3wg7x_, d3wg7y_, d3wg7z_ automated match to d1v54b2 complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 3wg7 (more details), 1.9 Å
SCOPe Domain Sequences for d3wg7o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wg7o1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d3wg7o1:
View in 3D Domains from other chains: (mouse over for more information) d3wg7a_, d3wg7b1, d3wg7b2, d3wg7c_, d3wg7d_, d3wg7e_, d3wg7f_, d3wg7g_, d3wg7h_, d3wg7i_, d3wg7j_, d3wg7k_, d3wg7l_, d3wg7m_, d3wg7n_, d3wg7p_, d3wg7q_, d3wg7r_, d3wg7s_, d3wg7t_, d3wg7u_, d3wg7v_, d3wg7w_, d3wg7x_, d3wg7y_, d3wg7z_ |