![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
![]() | Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) ![]() |
![]() | Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81432] (20 PDB entries) |
![]() | Domain d3wg7n_: 3wg7 N: [256496] Other proteins in same PDB: d3wg7b1, d3wg7b2, d3wg7c_, d3wg7d_, d3wg7e_, d3wg7f_, d3wg7g_, d3wg7h_, d3wg7i_, d3wg7j_, d3wg7k_, d3wg7l_, d3wg7m_, d3wg7o1, d3wg7o2, d3wg7p_, d3wg7q_, d3wg7r_, d3wg7s_, d3wg7t_, d3wg7u_, d3wg7v_, d3wg7w_, d3wg7x_, d3wg7y_, d3wg7z_ automated match to d1v54a_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 3wg7 (more details), 1.9 Å
SCOPe Domain Sequences for d3wg7n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wg7n_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d3wg7n_:
![]() Domains from other chains: (mouse over for more information) d3wg7a_, d3wg7b1, d3wg7b2, d3wg7c_, d3wg7d_, d3wg7e_, d3wg7f_, d3wg7g_, d3wg7h_, d3wg7i_, d3wg7j_, d3wg7k_, d3wg7l_, d3wg7m_, d3wg7o1, d3wg7o2, d3wg7p_, d3wg7q_, d3wg7r_, d3wg7s_, d3wg7t_, d3wg7u_, d3wg7v_, d3wg7w_, d3wg7x_, d3wg7y_, d3wg7z_ |